Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Translocon-associated protein subunit gamma(SSR3)

Recombinant Bovine Translocon-associated protein subunit gamma(SSR3)

SKU:CSB-CF667493BO

Regular price $2,142.00 CAD
Regular price Sale price $2,142.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q3SZ87

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPKGGPKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER ILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALL STGSK

Protein Names:Recommended name: Translocon-associated protein subunit gamma Short name= TRAP-gamma Alternative name(s): Signal sequence receptor subunit gamma Short name= SSR-gamma

Gene Names:Name:SSR3

Expression Region:1-185

Sequence Info:full length protein

View full details