Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 2(NKAIN2)

Recombinant Bovine Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 2(NKAIN2)

SKU:CSB-CF015825BO

Regular price $2,184.00 CAD
Regular price Sale price $2,184.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A6QNL6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGYCSGRCTLIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPR YITGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSV TPAPDWAPEDHRYITVSGCFLEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFD FIGGFDSYGYQGPQKTSHLQLQPMYMQIPLDNN

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2

Gene Names:Name:NKAIN2

Expression Region:1-213

Sequence Info:Full length protein

View full details