Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Short transient receptor potential channel 6(TRPC6)

Recombinant Bovine Short transient receptor potential channel 6(TRPC6)

SKU:CSB-CF865031BO

Regular price $2,000.60 CAD
Regular price Sale price $2,000.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q9MYW0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IFIMVFVAFMIGMFNLYSYYIGAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKF IENIGYVLYGVYNVTMVIVLLNMLIAMIN

Protein Names:Recommended name: Short transient receptor potential channel 6 Short name= TrpC6

Gene Names:Name:TRPC6 Synonyms:TRP6

Expression Region:1-89

Sequence Info:full length protein

View full details