Recombinant Bovine Resistin(RETN)

SKU: CSB-EP019573BOa2

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: Q762I5

Gene Names: RETN

Organism: Bos taurus (Bovine)

AA Sequence: QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ

Expression Region: 19-109aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 25.6 kDa

Alternative Name(s): RSTN

Relevance: Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes

Reference: "Gene expression of resistin and TNF-alpha in adipose tissue of Japanese Black steers and Holstein steers." Komatsu T., Itoh F., Hodate K., Hazegawa S., Obara Y., Kushibiki S. Anim. Sci. J. 76:567-573(2005)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.