Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 25-35 working days
Research Topic: Others
Uniprot ID: P84291
Gene Names: N/A
Organism: Bos taurus (Bovine)
AA Sequence: DSELAGPRGARGPHGLSGPHGLSGLXGPXGYTGPIGMXGLTGLRREESEKVWLESKDGQELELVSSGSAQEELELVSSGSAQVSFASYLGASQPLPSELW
Expression Region: 1-100aa
Sequence Info: Full Length
Source: Baculovirus
Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-tagged
MW: 54.3 kDa
Alternative Name(s):
Relevance:
Reference: "Characterization of a bovine pregnancy-associated protein using two-dimensional gel electrophoresis, N-terminal sequencing and mass spectrometry." Pyo J., Hwang S.-I., Oh J., Lee S.-J., Kang S.-C., Kim J.-S., Lim J. Proteomics 3:2420-2427(2003)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.