Recombinant Bovine Oxidized low-density lipoprotein receptor 1(OLR1)

SKU: CSB-CF016331BO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P79391

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTVDDPKGMKDQLDQKPNGKTAKGFVSSWRWYPAAVTLGVLCLGLLVTVILLILQLSQVSDLIKKQQANITHQEDILEGQILAQRRSEKSAQESQKELKEMIETLAHKLDEKSKKLMELHRQNLNLQEVLKEAANYSGPCPQDWLWHEENCYQFSSGSFNWEKSQENCLSLDAHLLKINSTDELEFIQQMIAHSSFPFWMGLSMRKPNYSWLWEDGTPLTPHLFRIQGAVSRMYPSGTCAYIQRGTVFAENCILTAFSICQKKANLLRAQ

Protein Names:Recommended name: Oxidized low-density lipoprotein receptor 1 Short name= Ox-LDL receptor 1 Alternative name(s): Lectin-like oxidized LDL receptor 1 Short name= LOX-1 Short name= Lectin-like oxLDL receptor 1 Short name= bLOX-1 Lectin-type oxidized LDL receptor 1 Cleaved into the following 2 chains: 1. Oxidized low-density lipoprotein receptor 1, soluble form A 2. Oxidized low-density lipoprotein receptor 1, soluble form B

Gene Names:Name:OLR1 Synonyms:LOX1

Expression Region:1-270

Sequence Info:full length protein