![Recombinant Bovine Odorant-binding protein](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_de8079ec-bc82-4e01-8f42-b8e23f882e06_{width}x.jpg?v=1659200192)
Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 25-35 working days
Research Topic: Others
Uniprot ID: P07435
Gene Names: N/A
Organism: Bos taurus (Bovine)
AA Sequence: ENLYFQGAQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Expression Region: 1-159aa
Sequence Info: Full Length
Source: Baculovirus
Tag Info: N-terminal 10xHis-tagged
MW: 21.9 kDa
Alternative Name(s): Olfactory mucosa pyrazine-binding protein
Relevance: This protein binds a wide variety of chemical odorants.
Reference: "Three-dimensional structure and active site of three hydrophobic molecule-binding proteins with significant amino acid sequence similarity." Monaco H.L., Zanotti G. Biopolymers 32:457-465(1992)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.