Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Leucine-rich repeat-containing protein 3(LRRC3)

Recombinant Bovine Leucine-rich repeat-containing protein 3(LRRC3)

SKU:CSB-CF013124BO

Regular price $2,200.80 CAD
Regular price Sale price $2,200.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A6H793

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CPQNCQCPDHAGAVAVHCSARGLQEVPRDIPADTVLLKLDANKIARIPNGAFQHLHQLRE LDLSQNAIETIGPAAFSGLAGGLRLLDLSHNRLRRIPKDALGKLSAKIRLAHNPLHCECA LQEALWELKLDPDSVDEIACHTSVQEEYVGKPLIQALDSGVSFCSVHHKTTDVAMLVTMF GWFAMVITYVVYYVRQNQEDARRHLEYLKSLPSTPMSKDPTSSAP

Protein Names:Recommended name: Leucine-rich repeat-containing protein 3

Gene Names:Name:LRRC3

Expression Region:33-257

Sequence Info:Full length protein

View full details