Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P49877
Gene Names: IFNAG
Organism: Bos taurus (Bovine)
AA Sequence: CHLPHTHSLANRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQFFSVEGSAVVWDESLLDKLRDALDQQLTDLQFCLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQERFRRKD
Expression Region: 24-189aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 21.2 kDa
Alternative Name(s): IFN-alpha7
Relevance: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Reference: "The cloning of cattle interferon-A subtypes isolated from the gut epithelium of rotavirus-infected calves."Chaplin P.J., Parsons K.R., Collins B.A.Immunogenetics 44:143-145(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.