Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine herpesvirus 1.1 Glycoprotein N(gN)

Recombinant Bovine herpesvirus 1.1 Glycoprotein N(gN)

SKU:CSB-CF751881BJS

Regular price $1,979.60 CAD
Regular price Sale price $1,979.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bovine herpesvirus 1.1 (strain Cooper) (BoHV-1) (Infectious bovine rhinotracheitis virus)

Uniprot NO.:Q77CE4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RDPLLDAMRREGAMDFWSAGCYARGVPLSEPPQALVVFYVALTAVMVAVALYAYGLCFRL MGASGPNKKESRGRG

Protein Names:Recommended name: Glycoprotein N Short name= gN

Gene Names:Name:gN ORF Names:UL49.5

Expression Region:22-96

Sequence Info:full length protein

View full details