Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine ER lumen protein retaining receptor 1(KDELR1)

Recombinant Bovine ER lumen protein retaining receptor 1(KDELR1)

SKU:CSB-CF012129BO

Regular price $2,182.60 CAD
Regular price Sale price $2,182.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P33946

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLDLFTNYISLYN TCMKVVYIACSFTTVWMIYSKFKATYDGNHDTFRVEFLVIPTAILAFLVNHDFTPLEILW TFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGVYRTLYLFNWIWRYHFEGFFDLIA IVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA

Protein Names:Recommended name: ER lumen protein retaining receptor 1 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 1 Short name= KDEL receptor 1

Gene Names:Name:KDELR1 Synonyms:KDELR

Expression Region:1-212

Sequence Info:Full length protein

View full details