Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine ephemeral fever virus Protein alpha-1(alpha)

Recombinant Bovine ephemeral fever virus Protein alpha-1(alpha)

SKU:CSB-CF714595BJQ

Regular price $1,999.20 CAD
Regular price Sale price $1,999.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bovine ephemeral fever virus (strain BB7721) (BEFV)

Uniprot NO.:Q65475

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKGLLSNFWNDFKRWSEDRKVEIVIWWSNLESKVRLGFWIILIILLGILAIRIAIKVYQ CVKFTNQGVKKIKRIIKRKRSIKKYRKT

Protein Names:Recommended name: Protein alpha-1

Gene Names:Name:alpha

Expression Region:1-88

Sequence Info:full length protein

View full details