Gene Bio Systems
Recombinant Bovine ephemeral fever virus Protein alpha-1(alpha)
Recombinant Bovine ephemeral fever virus Protein alpha-1(alpha)
SKU:CSB-CF714595BJQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bovine ephemeral fever virus (strain BB7721) (BEFV)
Uniprot NO.:Q65475
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEKGLLSNFWNDFKRWSEDRKVEIVIWWSNLESKVRLGFWIILIILLGILAIRIAIKVYQ CVKFTNQGVKKIKRIIKRKRSIKKYRKT
Protein Names:Recommended name: Protein alpha-1
Gene Names:Name:alpha
Expression Region:1-88
Sequence Info:full length protein
