Gene Bio Systems
Recombinant Bovine Cytochrome c oxidase subunit 6C(COX6C)
Recombinant Bovine Cytochrome c oxidase subunit 6C(COX6C)
SKU:CSB-CF005856BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:P04038
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDF EEMRKAGIFQSAK
Protein Names:Recommended name: Cytochrome c oxidase subunit 6C Alternative name(s): Cytochrome c oxidase polypeptide VIc Cytochrome c oxidase subunit STA
Gene Names:Name:COX6C
Expression Region:2-74
Sequence Info:Full length protein
