Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Cytochrome c oxidase subunit 4 isoform 1, mitochondrial(COX4I1)

Recombinant Bovine Cytochrome c oxidase subunit 4 isoform 1, mitochondrial(COX4I1)

SKU:CSB-CF005832BO

Regular price $2,086.00 CAD
Regular price Sale price $2,086.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P00423

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELY RLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQT KRMLDMKVAPIQGFSAKWDYDKNEWKK

Protein Names:Recommended name: Cytochrome c oxidase subunit 4 isoform 1, mitochondrial Alternative name(s): Cytochrome c oxidase polypeptide IV Cytochrome c oxidase subunit IV isoform 1 Short name= COX IV-1

Gene Names:Name:COX4I1 Synonyms:COX4

Expression Region:23-169

Sequence Info:Full length protein

View full details