Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine BCL2-adenovirus E1B 19 kDa protein-interacting protein 3(BNIP3)

Recombinant Bovine BCL2-adenovirus E1B 19 kDa protein-interacting protein 3(BNIP3)

SKU:CSB-CF656958BO

Regular price $2,158.80 CAD
Regular price Sale price $2,158.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q32KN2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQSESPGLQEESLHGSWVELHFGSNGNGSSVPDSVSIYKGDMEKILLDAQHESGRSSSK SSHCDSPPRSQTPQDTNRASETDTHSLGEKNSSQSEEDYMERRKEVESILKKNSDWIWDW SSRPENVPPAKEFLLFKHPKRTPTLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIG LGIYIGRRLTTSTSTF

Protein Names:Recommended name: BCL2/adenovirus E1B 19 kDa protein-interacting protein 3

Gene Names:Name:BNIP3

Expression Region:1-196

Sequence Info:full length protein

View full details