Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:P07926
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMVAFLILFAM
Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATP synthase proteolipid P2 ATPase protein 9 ATPase subunit c
Gene Names:Name:ATP5G2
Expression Region:69-143
Sequence Info:Full length protein