Recombinant Botryotinia fuckeliana  Assembly factor cbp4(cbp4)

Recombinant Botryotinia fuckeliana Assembly factor cbp4(cbp4)

CSB-CF412479BVD
Regular price
$1,467.00 CAD
Sale price
$1,467.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)

Uniprot NO.:A6SAY2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPPKPTNWRMYGKMAVAGLTCCVGGPALIYYISPTEEELFLKYNPELQKRSLENRVGKQE DFDNFVARLKEYSKSDRPIWVEAEEAARKKRSGKIEEQAKLMQEMQQRKEEIKKSGTNLM PGGSL

Protein Names:Recommended name: Assembly factor cbp4 Alternative name(s): Cytochrome b mRNA-processing protein 4

Gene Names:Name:cbp4 ORF Names:BC1G_09937

Expression Region:1-125

Sequence Info:full length protein

Your list is ready to share