Skip to product information
1 of 1

Gene Bio Systems

Recombinant Borrelia burgdorferi Uncharacterized protein BBD24 (BB_D24)

Recombinant Borrelia burgdorferi Uncharacterized protein BBD24 (BB_D24)

SKU:CSB-CF303226BUD

Regular price $1,981.00 CAD
Regular price Sale price $1,981.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Uniprot NO.:P70845

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAIIVYSCLTMCVIYFHLQLKTFFTKLIRFCKKCFDIFLLLIEMLKLIFYLLIINNKFY IFIIISIALITINTMI

Protein Names:Recommended name: Uncharacterized protein BBD24

Gene Names:Ordered Locus Names:BB_D24 ORF Names:CdsO

Expression Region:1-76

Sequence Info:full length protein

View full details