Gene Bio Systems
Recombinant Borrelia burgdorferi Uncharacterized protein BBD24 (BB_D24)
Recombinant Borrelia burgdorferi Uncharacterized protein BBD24 (BB_D24)
SKU:CSB-CF303226BUD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Uniprot NO.:P70845
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTAIIVYSCLTMCVIYFHLQLKTFFTKLIRFCKKCFDIFLLLIEMLKLIFYLLIINNKFY IFIIISIALITINTMI
Protein Names:Recommended name: Uncharacterized protein BBD24
Gene Names:Ordered Locus Names:BB_D24 ORF Names:CdsO
Expression Region:1-76
Sequence Info:full length protein
