Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O96870
Gene Names: BLOT5
Organism: Blomia tropicalis (Mite)
AA Sequence: MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Expression Region: 1-134aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 31.6 kDa
Alternative Name(s): Allergen: Blo t 5
Relevance:
Reference: "Sensitization to Blomia tropicalis in patients with asthma and identification of allergen Blo t 5."Arruda L.K., Vailes L.D., Platts-Mills T.A.E., Fernandez-Caldas E., Montealegre F., Lin K.-L., Chua K.-Y., Rizzo M.C., Naspitz C.K., Chapman M.D.Am. J. Respir. Crit. Care Med. 155:343-350(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.