Recombinant Blomia tropicalis Mite allergen Blo t 5(BLOT5)

Recombinant Blomia tropicalis Mite allergen Blo t 5(BLOT5)

CSB-EP527280BTN
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O96870

Gene Names: BLOT5

Organism: Blomia tropicalis (Mite)

AA Sequence: MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ

Expression Region: 1-134aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 31.6 kDa

Alternative Name(s): Allergen: Blo t 5

Relevance:

Reference: "Sensitization to Blomia tropicalis in patients with asthma and identification of allergen Blo t 5."Arruda L.K., Vailes L.D., Platts-Mills T.A.E., Fernandez-Caldas E., Montealegre F., Lin K.-L., Chua K.-Y., Rizzo M.C., Naspitz C.K., Chapman M.D.Am. J. Respir. Crit. Care Med. 155:343-350(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share