Gene Bio Systems
Recombinant Bifidobacterium longum UPF0233 membrane protein BL0593(BL0593)
Recombinant Bifidobacterium longum UPF0233 membrane protein BL0593(BL0593)
SKU:CSB-CF812706BGP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bifidobacterium longum (strain NCC 2705)
Uniprot NO.:Q8G6P5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEQVQAALNATADKATLTPQMQRMMNRQAENTKRVEETIKGTKSNPRWFVPLFCALMIIG LIWCVVYYLSPSGSWPIPNIGAWNLGIGFALIMIGFLMTMGWR
Protein Names:Recommended name: UPF0233 membrane protein BL0593
Gene Names:Ordered Locus Names:BL0593
Expression Region:1-103
Sequence Info:full length protein
