Gene Bio Systems
Recombinant Bifidobacterium longum Protein CrcB homolog 3(crcB3)
Recombinant Bifidobacterium longum Protein CrcB homolog 3(crcB3)
SKU:CSB-CF816703BGP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bifidobacterium longum (strain NCC 2705)
Uniprot NO.:Q8G5C2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTVFLPILVCLCGGVGASCRYLLDVTIKTYWQRAFPLSTFTINLIAGFLAGLVAALALGG TLDEPWRLVLATGFLGGFSTFSTAINEMVTLFRKHRYPTAAAYLVLSLGVPVVAAACGFL V
Protein Names:Recommended name: Protein CrcB homolog 3
Gene Names:Name:crcB3 Ordered Locus Names:BL1092
Expression Region:1-121
Sequence Info:full length protein
