Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bat coronavirus 512-2005 Non-structural protein 3(3)

Recombinant Bat coronavirus 512-2005 Non-structural protein 3(3)

SKU:CSB-CF612693BFC

Regular price $2,199.40 CAD
Regular price Sale price $2,199.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bat coronavirus 512/2005 (BtCoV) (BtCoV/512/2005)

Uniprot NO.:Q0Q465

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFLGLFQYTIDTAVEHTVEHANLSQEEALMLEENIVPLRQATHVTGFLLTSVFVYFFALF KASSYKRNLLLFLARLLALLIYAPILIFCGAYLDAFIVVATLTSRLLFLTYYSWRYKTYK FLIYNSSTLMFLHGHANYYNGRPYVMLEGGSHYVTLGTDIVPFVSRSNLYLAIRGSAESD IQLLRTVELLDGNYLYIFSSCQVVGVTNSGFEEIQLDEYATISE

Protein Names:Recommended name: Non-structural protein 3 Short name= ns3 Alternative name(s): Accessory protein 3a

Gene Names:ORF Names:3

Expression Region:1-224

Sequence Info:full length protein

View full details