Gene Bio Systems
Recombinant Bat coronavirus 279-2005 Protein 7a(7a)
Recombinant Bat coronavirus 279-2005 Protein 7a(7a)
SKU:CSB-CF611307BFB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)
Uniprot NO.:Q0Q470
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCISTHFAFACADGTRHTY QLRARSVSPKLFTRQEEVHQELYSPLFLIVAALVFIILCFTIKRKTE
Protein Names:Recommended name: Protein 7a Alternative name(s): Accessory protein 7a
Gene Names:ORF Names:7a
Expression Region:16-122
Sequence Info:full length protein
