Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bartonella tribocorum NADH-quinone oxidoreductase subunit K(nuoK)

Recombinant Bartonella tribocorum NADH-quinone oxidoreductase subunit K(nuoK)

SKU:CSB-CF432779BOS

Regular price $2,020.20 CAD
Regular price Sale price $2,020.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bartonella tribocorum (strain CIP 105476 / IBS 506)

Uniprot NO.:A9IUM6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYIDITHYLTVSALMFTIGIAGIFLNRKNVIIILMSIELILLSVNINFVAFSAFLHDLVG QIFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K

Gene Names:Name:nuoK Ordered Locus Names:BT_1207

Expression Region:1-102

Sequence Info:full length protein

View full details