Gene Bio Systems
Recombinant Barley stripe mosaic virus Movement protein TGB3
Recombinant Barley stripe mosaic virus Movement protein TGB3
SKU:CSB-CF356386BEM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Barley stripe mosaic virus (BSMV)
Uniprot NO.:P04868
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAMPHPLECCCPQCLPSSESFPIYGEQEIPCSETQAETTPVEKTVRANVLTDILDDHYYA ILASLFIIALWLLYIYLSSIPTETGPYFYQDLNSVKIYGIGATNPEVIAAIHHWQKYPFG ESPMWGGLISVLSILLKPLTLVFALSFFLLLSSKR
Protein Names:Recommended name: Movement protein TGB3 Alternative name(s): 17 kDa protein Beta-C protein Triple gene block 3 protein Short name= TGBp3
Gene Names:
Expression Region:1-155
Sequence Info:full length protein
