Gene Bio Systems
Recombinant Bacteroides vulgatus Large-conductance mechanosensitive channel(mscL)
Recombinant Bacteroides vulgatus Large-conductance mechanosensitive channel(mscL)
SKU:CSB-CF405802BOP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154)
Uniprot NO.:A6L685
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGKSSFLQDFKAFAMRGNVIDMAVGVIIGGAFGKIVSSIVADVIMPPIGLLVGGVNFTDL KLQLKPAEVVDGVEKAAVTLNYGNFLQATFDFIIIAFSIFLFIRLLAKLNRKKEEVPAPA APPAPSKEEVLLTEIRDLLKEQAGKK
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:BVU_3586
Expression Region:1-146
Sequence Info:full length protein
