GeneBio Systems
Recombinant Bacteriophage H30 Shiga-like toxin 1 subunit B (stxB)
Recombinant Bacteriophage H30 Shiga-like toxin 1 subunit B (stxB)
SKU:P69178
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P69178
Gene Names: stxB
Alternative Name(s): SLT-1 B subunit;SLT-1b;SLT-Ib;Verocytotoxin 1 subunit B;Verotoxin 1 subunit B
Abbreviation: Recombinant Bacteriophage H30 stxB protein
Organism: Bacteriophage H30
Source: Yeast
Expression Region: 21-89aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-sumostar-tagged
Target Protein Sequence: TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
MW: 20.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Reference:
Function:
