Gene Bio Systems
Recombinant Bacillus subtilis Uncharacterized protein yxeC(yxeC)
Recombinant Bacillus subtilis Uncharacterized protein yxeC(yxeC)
SKU:CSB-CF345819BRJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:P54942
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGITKRGAAWEWLHSWWMLFIFMPFAITSFFAFLFIGIKVRNRKWIMYGIIYFFIFAFGF VLPDLPGVFIVVPLWAVTIIHGFKVRPLYLIQLDVYKDHVEARAFAEARSEAESRFHAPK QSIQDIHIRKEQ
Protein Names:Recommended name: Uncharacterized protein yxeC
Gene Names:Name:yxeC Ordered Locus Names:BSU39600 ORF Names:HS74C
Expression Region:1-132
Sequence Info:full length protein
