Recombinant Bacillus subtilis  Uncharacterized protein ypmT(ypmT)

Recombinant Bacillus subtilis Uncharacterized protein ypmT(ypmT)

CSB-CF346924BRJ
Regular price
$1,403.00 CAD
Sale price
$1,403.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P54180

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKRIYQYFSLLSFTFSLYFGWLAYHHLAAEDMDQMYLNVSYCALFLSVMVFTFGMRDRKK TDKS

Protein Names:Recommended name: Uncharacterized protein ypmT

Gene Names:Name:ypmT Ordered Locus Names:BSU21720

Expression Region:1-64

Sequence Info:full length protein

Your list is ready to share