Gene Bio Systems
Recombinant Bacillus subtilis Uncharacterized membrane protein ysxD(ysxD)
Recombinant Bacillus subtilis Uncharacterized membrane protein ysxD(ysxD)
SKU:CSB-CF331216BRJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:P40736
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKQKSILFPCLLLAASVYAWLESGQAELFSGQDQWPVLLMLLGAAFVYQGKKEAVTPHFF IGLLLFGIGLHFFAKPKWVWWPDDFEMLLFMIGFSLLVSTVQKKEYVYEAVSMICFSLFL YFFKQIMAWLESAHIPTALLKEYWPFVFIGISLLLLLIKRKKSIR
Protein Names:Recommended name: Uncharacterized membrane protein ysxD Alternative name(s): ORFY
Gene Names:Name:ysxD Ordered Locus Names:BSU28180
Expression Region:1-165
Sequence Info:full length protein
