Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Teichuronic acid biosynthesis protein tuaF(tuaF)

Recombinant Bacillus subtilis Teichuronic acid biosynthesis protein tuaF(tuaF)

SKU:CSB-CF518381BRJ

Regular price $2,203.60 CAD
Regular price Sale price $2,203.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O32269

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNDILIRIARRIKKNIIWIIAVPIILGAAGYILPSQIADQKSYTAEDTLAVGSYDHPVYN STEEIPLLLKSDSFLKEALPDEKDEDVAEIKEKLTINTESKSLLTLSYSDEDKDRTESVL NAISSTFLKNDQKLYAEREAVIRSSIDALEGESVSEDSKVDKERFLYELKNTQLNLKAAS VTDSETVSETAGGGMSPKKKAVLGVMIGLTIAFMFVVIPEFFRESF

Protein Names:Recommended name: Teichuronic acid biosynthesis protein tuaF

Gene Names:Name:tuaF Synonyms:yvhF Ordered Locus Names:BSU35560

Expression Region:1-226

Sequence Info:full length protein

View full details