Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis subsp. spizizenii Quinol oxidase subunit 4(qoxD)

Recombinant Bacillus subtilis subsp. spizizenii Quinol oxidase subunit 4(qoxD)

SKU:CSB-CF515183BRM

Regular price $1,831.25 CAD
Regular price Sale price $1,831.25 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)

Uniprot NO.:E0TW64

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ANKSAEHSHFPWKHIVGFALSIVLTLLALWVAVYTDLSSSAKLWIIFGFAFIQAALQLLM FMHMTESENGGIQVGNTLFGFFGAIVIVLGSIWIFAAHYHHGDHMDGNPPGGAEHSEHSG HNE

Protein Names:Recommended name: Quinol oxidase subunit 4 EC= 1.10.3.- Alternative name(s): Quinol oxidase aa3-600, subunit qoxD Quinol oxidase polypeptide IV

Gene Names:Name:qoxD Ordered Locus Names:BSUW23_18860

Expression Region:2-124

Sequence Info:full length protein

View full details