Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Riboflavin transporter FmnP(fmnP)

Recombinant Bacillus subtilis Riboflavin transporter FmnP(fmnP)

SKU:CSB-CF343876BRJ

Regular price $2,150.40 CAD
Regular price Sale price $2,150.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P50726

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKVKKLVVVSMLSSIAFVLMLLNFPFPGLPDYLKIDFSDVPAIIAILIYGPLAGIAVEAI KNVLQYIIQGSMAGVPVGQVANFIAGTLFILPTAFLFKKLNSAKGLAVSLLLGTAAMTIL MSILNYVLILPAYTWFLHSPALSDSALKTAVVAGILPFNMIKGIVITVVFSLIFIKLKPW IEQQRSAHIH

Protein Names:Recommended name: Riboflavin transporter FmnP Alternative name(s): FMN permease Riboflavin ECF transporter S component FmnP

Gene Names:Name:fmnP Synonyms:ribU, ypaA Ordered Locus Names:BSU23050

Expression Region:1-190

Sequence Info:full length protein

View full details