Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Penicillin-binding protein 3(pbpC),partial

Recombinant Bacillus subtilis Penicillin-binding protein 3(pbpC),partial

SKU:CSB-EP331705BRJ

Regular price $1,492.40 CAD
Regular price Sale price $1,492.40 CAD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein: pbpC

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Bacillus subtilis (strain 168)

Delivery time: 3-7 business days

Uniprot ID: P42971

AA Sequence: CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT

Tag info: N-terminal 6xHis-tagged

Expression Region: 21-240aa

Protein length: Partial

MW: 29.2 kDa

Alternative Name(s): PBP 3 Alternative name(s): PSPB20 Penicillin-binding protein C

Relevance:

Reference: "The complete genome sequence of the Gram-positive bacterium Bacillus subtilis."Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. Danchin A.Nature 390:249-256(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details