Gene Bio Systems
Recombinant Bacillus subtilis Modification methylase BglII(bglIIM)
Recombinant Bacillus subtilis Modification methylase BglII(bglIIM)
SKU:CSB-EP670450BRI
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q45489
Gene Names: bglIIM
Organism: Bacillus subtilis (strain 168)
AA Sequence: MSEDQYKQIKLHLGMEDDNEDLPNHIPSSFPKQHLNKIYNGDTMNMLLDIPDNSVDLVVTSPPYNINKFKNDRRPLEEYLKWQTEIIEQCHRVLKPSGSIFWQVGTYVNDSGAHIPLDIRFFPIFESLGMFPRNRIVWVRPHGLHANKKFAGRHETILWFTKTPEYKFFLDPIRVPQKYANKKHYKGDKKGELSGDPLGKNPGDVWAFRNVRHNHEEDTIHPTQYPEDMIERIVLSTTEPNDIVLDPFIGMGTTASVAKNLNRYFYGAEIEKEYVDIAYQILSGEPDENNNFPNLKTLRQYCEKNGIIDPSQYTFTRQRKGSKPSLDSKAHPEEHHKKEIVERIEFEAENSVYKKVQNEQ
Expression Region: 1-360aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 58 kDa
Alternative Name(s): N(4)- cytosine-specific methyltransferase BglII
Relevance: This methylase recognizes the double-stranded sequence AGATCT, causes specific methylation on C-5 on both strands, and protects the DNA from cleavage by the BglII endonuclease.
Reference: Cloning and characterization of the BglII restriction-modification system reveals a possible evolutionary footprint.Anton B.P., Heiter D.F., Benner J.S., Hess E.J., Greenough L., Moran L.S., Slatko B.E., Brooks J.E.Gene 187:19-27(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.