Gene Bio Systems
Recombinant Bacillus sp. Levanase,partial
Recombinant Bacillus sp. Levanase,partial
SKU:CSB-EP523248BRG
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O31411
Gene Names: N/A
Organism: Bacillus sp. (strain L7)
AA Sequence: LPWNDLGHVWSGSAVADTTNASGLFGSSGGKGLIAYYTSYNPDRHNGNQKIGLAYSTDRGRTWKYSEEHPVVIENPGKTGEDPGGWDFRDPKVVRDEANNRWVMVVSGGDHIRLFTSTNLLNWTLTDQF
Expression Region: 451-579aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 30.3 kDa
Alternative Name(s): 2,6-beta-D-fructan fructanohydrolase Endo-levanase
Relevance: Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.
Reference: "Characterization of a novel endo-levanase and its gene from Bacillus sp. L7."Miasnikov A.N.FEMS Microbiol. Lett. 154:23-28(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
