Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus pumilus UPF0316 protein BPUM_0594 (BPUM_0594)

Recombinant Bacillus pumilus UPF0316 protein BPUM_0594 (BPUM_0594)

SKU:CSB-CF421332BOL

Regular price $2,140.60 CAD
Regular price Sale price $2,140.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus pumilus (strain SAFR-032)

Uniprot NO.:A8FAL9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLQQLLSNAFTMVLIILVINIVYVSFSTMRLILTMKGRRYAAAFAGTIEMLIYVIGLSIV LDNLDQIQNVIAYALGYGMGIIVGMKIEEKLALGYTTVNVITKELDVDLPRQLREKGYGV TSWVAGGLEGDRTALQILTPRKYELQLYETIKTLDSKAFIISYEPKSIHGGFWVKAVKKR RIKE

Protein Names:Recommended name: UPF0316 protein BPUM_0594

Gene Names:Ordered Locus Names:BPUM_0594

Expression Region:1-184

Sequence Info:full length protein

View full details