Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus pseudofirmus Membrane protein insertase YidC(yidC)

Recombinant Bacillus pseudofirmus Membrane protein insertase YidC(yidC)

SKU:CSB-CF526002BRB

Regular price $2,213.40 CAD
Regular price Sale price $2,213.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus pseudofirmus (strain OF4)

Uniprot NO.:O87567

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CGANGQPITAETEGIWNHFFVYPLSWVLISVADLLNGSFGLSIIVVTIGIRLFLLPLMIK QQKSSRAMQALRPEMEALQKKYGQGTKRDPKDQQKMQKELMALYKDSGVNPMAGCLPLFI QLPVMMAFYFAIMRTEVIALHSFLWFDLGSPDPLYILPVVAGITTFLQVKMTSFQLNDQM KVIIYIMPVMIVVAGVTLPSALSLYWVVGNLFMIIQTYFTVVRFEQLKTDISK

Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC

Gene Names:Name:yidC Ordered Locus Names:BpOF4_11410

Expression Region:20-252

Sequence Info:full length protein

View full details