Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus licheniformis UPF0059 membrane protein BLi03939-BL03987(BLi03939, BL03987)

Recombinant Bacillus licheniformis UPF0059 membrane protein BLi03939-BL03987(BLi03939, BL03987)

SKU:CSB-CF723851BQU

Regular price $2,143.40 CAD
Regular price Sale price $2,143.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Uniprot NO.:Q65DW1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVDVLIGEILTLSMMAFALGMDAFSVGLGMGMAKLKRNQVFQIGVIIGLFHVIMPLGGM IAGQFLSGALGALAGYIGGALLLVLGIQMIVASFNKSGEQIISPHGFGLFVFAVGVSLDS FSVGLSLGLYGTKPILTIFLFGLFSMVLTWAGLLLGKKVQTWLGAYSEALGGAILLSFGL KLLLPI

Protein Names:Recommended name: UPF0059 membrane protein BLi03939/BL03987

Gene Names:Ordered Locus Names:BLi03939, BL03987

Expression Region:1-186

Sequence Info:full length protein

View full details