Recombinant Bacillus licheniformis N-acetylmuramoyl-L-alanine amidase CwlM(cwlM)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Bacillus licheniformis N-acetylmuramoyl-L-alanine amidase CwlM(cwlM)

CSB-EP339780BQT
Regular price
$1,332.50 CAD
Sale price
$1,332.50 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P37134

Gene Names: cwlM

Organism: Bacillus licheniformis

AA Sequence: MVKIFIDPGHGGSDTGASANGLQEKQLTLQTALALRNMLLNEYQNVSVLLSRTSDQTVSLTQRTNAANSWGADYFLSIHMNAGGGTGFEDYIYPGVGAPTTTYRDIMHEEILKVVDFRDRGKKTANFHVLRETAMPALLTENGFVDNTNDAEKLKSSAFIQSIARGHANGLARAFNLSKNAAALYKVQIAAFRTKANADSLAAQAEAKGFDALVIYRDSLYKVQIGAFSSKENAEALVQQAKNAEFDTFIYQE

Expression Region: 1-253aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 43.6 kDa

Alternative Name(s): Autolysin;Cell wall hydrolase

Relevance: Hydrolyzes the cell wall of M.luteus more efficiently than that of B.licheniformis and B.subtilis. The C-terminal region, including the repeats, determines substrate specificity.

Reference: Genetic structure, isolation and characterization of a Bacillus licheniformis cell wall hydrolase.Kuroda A., Sugimoto Y., Funahashi T., Sekiguchi J.Mol. Gen. Genet. 234:129-137(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share