
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P37134
Gene Names: cwlM
Organism: Bacillus licheniformis
AA Sequence: MVKIFIDPGHGGSDTGASANGLQEKQLTLQTALALRNMLLNEYQNVSVLLSRTSDQTVSLTQRTNAANSWGADYFLSIHMNAGGGTGFEDYIYPGVGAPTTTYRDIMHEEILKVVDFRDRGKKTANFHVLRETAMPALLTENGFVDNTNDAEKLKSSAFIQSIARGHANGLARAFNLSKNAAALYKVQIAAFRTKANADSLAAQAEAKGFDALVIYRDSLYKVQIGAFSSKENAEALVQQAKNAEFDTFIYQE
Expression Region: 1-253aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 43.6 kDa
Alternative Name(s): Autolysin;Cell wall hydrolase
Relevance: Hydrolyzes the cell wall of M.luteus more efficiently than that of B.licheniformis and B.subtilis. The C-terminal region, including the repeats, determines substrate specificity.
Reference: Genetic structure, isolation and characterization of a Bacillus licheniformis cell wall hydrolase.Kuroda A., Sugimoto Y., Funahashi T., Sekiguchi J.Mol. Gen. Genet. 234:129-137(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.