Gene Bio Systems
Recombinant Bacillus halodurans UPF0295 protein BH0952(BH0952)
Recombinant Bacillus halodurans UPF0295 protein BH0952(BH0952)
SKU:CSB-CF867742BQS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Uniprot NO.:Q9KEA2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGIKYSNKINKIRTFALSLVFLGILVMYIGIFFRTHEVIMVLAMILGFLCIIASTAVYFW IGMISTRAIPVVCPECGKPTKVLGRVDACMHCDQPLTLDRSLEGKEFDEKYNLKGKKRVD G
Protein Names:Recommended name: UPF0295 protein BH0952
Gene Names:Ordered Locus Names:BH0952
Expression Region:1-121
Sequence Info:full length protein
