Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus halodurans UPF0295 protein BH0952(BH0952)

Recombinant Bacillus halodurans UPF0295 protein BH0952(BH0952)

SKU:CSB-CF867742BQS

Regular price $2,048.20 CAD
Regular price Sale price $2,048.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Uniprot NO.:Q9KEA2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGIKYSNKINKIRTFALSLVFLGILVMYIGIFFRTHEVIMVLAMILGFLCIIASTAVYFW IGMISTRAIPVVCPECGKPTKVLGRVDACMHCDQPLTLDRSLEGKEFDEKYNLKGKKRVD G

Protein Names:Recommended name: UPF0295 protein BH0952

Gene Names:Ordered Locus Names:BH0952

Expression Region:1-121

Sequence Info:full length protein

View full details