Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: Q9KF49
Gene Names: BH0637
Organism: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
AA Sequence: MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWIYQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSFANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDPQTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTLTQMSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHSSIRSDLAKILREMKELGIDDFSRCMLTTDGSPPSFYEQGIMDRLIKIALDEGIPPKDAYGMATYYVARYYGLD
Expression Region: 1-328aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 57.7 kDa
Alternative Name(s):
Relevance:
Reference: "Complete genome sequence of the alkaliphilic bacterium Bacillus halodurans and genomic sequence comparison with Bacillus subtilis." Takami H., Nakasone K., Takaki Y., Maeno G., Sasaki R., Masui N., Fuji F., Hirama C., Nakamura Y., Ogasawara N., Kuhara S., Horikoshi K. Nucleic Acids Res. 28:4317-4331(2000)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.