Gene Bio Systems
Recombinant Bacillus halodurans Membrane protein insertase YidC 1(yidC1)
Recombinant Bacillus halodurans Membrane protein insertase YidC 1(yidC1)
SKU:CSB-CF865672BQS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Uniprot NO.:Q9RCA5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CFNVNEPINAQSEGIWDSYFVYPLSWLMIYFANAFNGSFGLAIIVVTLLIRLLILPLMIK QLKSTRAMQALQPEMQALREKYSAKDQRTQQKLQQETMALFQKHGVNPLAGCFPVLIQMP ILLAFYHAIMRTREIGDEHFLWFVLNQPDPILLPIIAGITTFLQQKMMMVTDNPQMKVLL YVMPVMILVFAMFLPSSLALYWVIGNLFMILQTYFITGPNVGAKKVAADVKVGGKKK
Protein Names:Recommended name: Membrane protein insertase YidC 1 Alternative name(s): Foldase YidC 1 Membrane integrase YidC 1 Membrane protein YidC 1
Gene Names:Name:yidC1 Ordered Locus Names:BH4064
Expression Region:21-257
Sequence Info:full length protein
