Gene Bio Systems
Recombinant Bacillus cereus Antiholin-like protein LrgA(lrgA)
Recombinant Bacillus cereus Antiholin-like protein LrgA(lrgA)
SKU:CSB-CF770536BAM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus cereus (strain ATCC 14579 / DSM 31)
Uniprot NO.:Q814J2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKMSTKKVYSFLLQAFIFSAIMLISNIIATHLPIPMPSSVIGLVILFSLLCLKVIKLEQ VESLGTALTGIIGFLFVPSGISVINSLGVMGQYFVQILTVIVVATVILLAVTGLFAQFIL GKDEKETEDIKELKVVNKGRKHGKVA
Protein Names:Recommended name: Antiholin-like protein LrgA
Gene Names:Name:lrgA Ordered Locus Names:BC_5439
Expression Region:1-146
Sequence Info:full length protein
