Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus anthracis UPF0059 membrane protein BAMEG_5613 (BAMEG_5613)

Recombinant Bacillus anthracis UPF0059 membrane protein BAMEG_5613 (BAMEG_5613)

SKU:CSB-CF501670BQG

Regular price $2,137.80 CAD
Regular price Sale price $2,137.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus anthracis (strain CDC 684 / NRRL 3495)

Uniprot NO.:C3LFJ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI

Protein Names:Recommended name: UPF0059 membrane protein BAMEG_5613

Gene Names:Ordered Locus Names:BAMEG_5613

Expression Region:1-182

Sequence Info:full length protein

View full details