Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus amyloliquefaciens UPF0316 protein RBAM_006820 (RBAM_006820)

Recombinant Bacillus amyloliquefaciens UPF0316 protein RBAM_006820 (RBAM_006820)

SKU:CSB-CF424976BQD

Regular price $2,140.60 CAD
Regular price Sale price $2,140.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus amyloliquefaciens (strain FZB42)

Uniprot NO.:A7Z241

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMQTILSNSIGMVLIILIINIIYVSFFTIRMILTLKGQRYFAAGISTIEILVYVTGLSLV LGNLNQIQNVIAYALGYGLGVIVGMKIEEKLALGYITVNVITKELDLDLPKQLREKGYGV TSWVAGGLEGDRTAMQILTPRKYELQLYDTIKTLDEKAFMIAFEPKTIHGGFWVKAVKKR RIKE

Protein Names:Recommended name: UPF0316 protein RBAM_006820

Gene Names:Ordered Locus Names:RBAM_006820

Expression Region:1-184

Sequence Info:full length protein

View full details