Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus amyloliquefaciens UPF0295 protein RBAM_008830 (RBAM_008830)

Recombinant Bacillus amyloliquefaciens UPF0295 protein RBAM_008830 (RBAM_008830)

SKU:CSB-CF421845BQD

Regular price $1,822.50 CAD
Regular price Sale price $1,822.50 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus amyloliquefaciens (strain FZB42)

Uniprot NO.:A7Z2P1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKYSSKINKIRTFALSLVFVGFIIMYIGLFFKQSVLLASLFMILGLLSIGLSTAVYFWI GMLSTKAVRVMCPACEKETKILGRVDMCMHCREPLTLDKGLEGKAFDESYNRKNSVK

Protein Names:Recommended name: UPF0295 protein RBAM_008830

Gene Names:Ordered Locus Names:RBAM_008830

Expression Region:1-117

Sequence Info:full length protein

View full details