Recombinant Avian infectious bronchitis virus  Envelope small membrane protein(E)

Recombinant Avian infectious bronchitis virus Envelope small membrane protein(E)

CSB-CF356466ARW
Regular price
$1,450.00 CAD
Sale price
$1,450.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Avian infectious bronchitis virus (strain M41) (IBV)

Uniprot NO.:P05139

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMNLLNKSLEENGSFLTALYIIVGFLALYLLGRALQAFVQAADACCLFWYTWVVIPGAKG TAFVYKYTYGRKLNNPELEAVIVNEFPKNGWNNKNPANFQDAQRDKLYS

Protein Names:Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein Alternative name(s): 3c protein

Gene Names:Name:E Synonyms:sM ORF Names:3c

Expression Region:1-109

Sequence Info:full length protein

Your list is ready to share