Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Avian infectious bronchitis virus (strain Portugal/322/82) (IBV)
Uniprot NO.:P30246
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMNLLNKSLEENGSVLTAFYIFVAFVALYLLGRALQAFVQAADACCLFWYTWVVVPGAKG TTFVYKHTYGKKLNKPELETVIVNEFPKNGWKQ
Protein Names:Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein Alternative name(s): 3c protein
Gene Names:Name:E Synonyms:sM ORF Names:3c
Expression Region:1-93
Sequence Info:full length protein