
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Paulinella chromatophora
Uniprot NO.:B1X3Y2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSDLTSAASVLAAALAVGLAAIGPGIGQGTAAGSAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFVK
Protein Names:Recommended name: ATP synthase subunit C, organellar chromatophore Alternative name(s): ATP synthase F0 sector subunit C ATPase subunit III Lipid-binding protein
Gene Names:Name:atpE Synonyms:atpH Ordered Locus Names:PCC_0201
Expression Region:1-82
Sequence Info:full length protein